SCOPe 2.07: Domain d1qyyg_: 1qyy G:

Lineage for d1qyyg_ (1qyy G:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)

8. Domain d1qyyg_: 1qyy G: [96606]
   complexed with nag, pt

Details for d1qyyg_

PDB Entry: 1qyy, 2.8 Å

PDB Description: crystal structure of n-terminal domain of human platelet receptor glycoprotein ib-alpha at 2.8 angstrom resolution

PDB Compounds: (G:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d1qyyg_:

Sequence; same for both SEQRES and ATOM records:

>d1qyyg_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltql
nldraeltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcpt

Timeline for d1qyyg_:

• d1qyyg_ first appeared in SCOP 1.67
  
• d1qyyg_ appears in SCOPe 2.06
  
• d1qyyg_ appears in the current release, SCOPe 2.08