Lineage for d1qw5a_ (1qw5 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1443752Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1443753Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1443754Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1443755Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1443955Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1443999Domain d1qw5a_: 1qw5 A: [96459]
    complexed with 14w, h4b, hem, zn

Details for d1qw5a_

PDB Entry: 1qw5 (more details), 2.7 Å

PDB Description: murine inducible nitric oxide synthase oxygenase domain in complex with w1400 inhibitor.
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d1qw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw5a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw

SCOPe Domain Coordinates for d1qw5a_:

Click to download the PDB-style file with coordinates for d1qw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qw5a_: