Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) |
Protein Ribosomal protein L23 [54191] (2 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries) |
Domain d1qvgr_: 1qvg R: [96410] Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_ complexed with cd, cl, k, mg, na |
PDB Entry: 1qvg (more details), 2.9 Å
SCOP Domain Sequences for d1qvgr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvgr_ d.12.1.1 (R:) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqevasri
Timeline for d1qvgr_:
View in 3D Domains from other chains: (mouse over for more information) d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_ |