SCOP 1.73: Domain d1qvgr_: 1qvg R:

Lineage for d1qvgr_ (1qvg R:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)

8. Domain d1qvgr_: 1qvg R: [96410]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   complexed with cd, cl, k, mg, na

Details for d1qvgr_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (R:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1qvgr_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgr_ d.12.1.1 (R:) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1qvgr_:

• d1qvgr_ first appeared in SCOP 1.67
  
• d1qvgr_ appears in SCOP 1.71
  
• d1qvgr_ appears in SCOP 1.75
  
• d1qvgr_ appears in the current release, SCOPe 2.08