Lineage for d1qcya_ (1qcy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892236Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 2892237Species Human (Homo sapiens) [TaxId:9606] [53311] (4 PDB entries)
  8. 2892244Domain d1qcya_: 1qcy A: [96340]
    complexed with mg

Details for d1qcya_

PDB Entry: 1qcy (more details), 2.3 Å

PDB Description: the crystal structure of the i-domain of human integrin alpha1beta1
PDB Compounds: (A:) I-domain of integrin alpha1beta1

SCOPe Domain Sequences for d1qcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcya_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}
tqldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefnlnkys
steevlvaakkivqrggaqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnh
rlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdelal
vtivktlgerifa

SCOPe Domain Coordinates for d1qcya_:

Click to download the PDB-style file with coordinates for d1qcya_.
(The format of our PDB-style files is described here.)

Timeline for d1qcya_: