Lineage for d1q9ca_ (1q9c A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2312488Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2312501Protein Histone domain of Son of sevenless protein [101107] (1 species)
  7. 2312502Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry)
  8. 2312503Domain d1q9ca_: 1q9c A: [96258]

Details for d1q9ca_

PDB Entry: 1q9c (more details), 3.21 Å

PDB Description: Crystal Structure of the Histone domain of Son of Sevenless
PDB Compounds: (A:) Son of sevenless protein

SCOPe Domain Sequences for d1q9ca_:

Sequence, based on SEQRES records: (download)

>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfh

Sequence, based on observed residues (ATOM records): (download)

>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaieslpvekihpllkevlgykidhqvsvyivav
leyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfh

SCOPe Domain Coordinates for d1q9ca_:

Click to download the PDB-style file with coordinates for d1q9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1q9ca_: