Lineage for d1q86y_ (1q86 Y:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410314Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 410315Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 410316Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 410317Protein Ribosomal protein L31e [54577] (1 species)
  7. 410318Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (18 PDB entries)
  8. 410336Domain d1q86y_: 1q86 Y: [96190]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q86y_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

SCOP Domain Sequences for d1q86y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q86y_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1q86y_:

Click to download the PDB-style file with coordinates for d1q86y_.
(The format of our PDB-style files is described here.)

Timeline for d1q86y_: