Lineage for d1q86q_ (1q86 Q:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720880Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2720881Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2720882Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2720883Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2720884Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2720939Domain d1q86q_: 1q86 Q: [96182]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, pha

Details for d1q86q_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (Q:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d1q86q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q86q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1q86q_:

Click to download the PDB-style file with coordinates for d1q86q_.
(The format of our PDB-style files is described here.)

Timeline for d1q86q_: