SCOPe 2.04: Domain d1q824_: 1q82 4:

Lineage for d1q824_ (1q82 4:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
   automatically mapped to Pfam PF00935

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1q824_: 1q82 4: [96127]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q824_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

PDB Compounds: (4:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1q824_:

Sequence; same for both SEQRES and ATOM records:

>d1q824_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1q824_:

• d1q824_ first appeared in SCOP 1.67
  
• d1q824_ appears in SCOPe 2.03
  
• d1q824_ appears in SCOPe 2.05
  
• d1q824_ appears in the current release, SCOPe 2.08