Lineage for d1q81o_ (1q81 O:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887539Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2887540Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2887541Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 2887581Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
    Uniprot P14123
  8. 2887617Domain d1q81o_: 1q81 O: [96112]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu
    has additional insertions and/or extensions that are not grouped together

Details for d1q81o_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (O:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d1q81o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d1q81o_:

Click to download the PDB-style file with coordinates for d1q81o_.
(The format of our PDB-style files is described here.)

Timeline for d1q81o_: