SCOP 1.67: Domain d1q5yb_: 1q5y B:

Lineage for d1q5yb_ (1q5y B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (4 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)

6. Protein Nickel responsive regulator NikR, C-terminal domain [103000] (1 species)

7. Species Escherichia coli [TaxId:562] [103001] (2 PDB entries)

8. Domain d1q5yb_: 1q5y B: [95951]

Details for d1q5yb_

PDB Entry: 1q5y, 1.4 Å

PDB Description: Nickel-Bound C-terminal Regulatory Domain of NikR

SCOP Domain Sequences for d1q5yb_:

Sequence; same for both SEQRES and ATOM records:

>d1q5yb_ d.58.18.4 (B:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli}
tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq
hfaddviaqrgvrhghlqclpke

Timeline for d1q5yb_:

• d1q5yb_ is new in SCOP 1.67
  
• d1q5yb_ appears in SCOP 1.69
  
• d1q5yb_ appears in the current release, SCOPe 2.08