Lineage for d1q4gb2 (1q4g B:32-73)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1460212Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 1460254Species Sheep (Ovis aries) [TaxId:9940] [57211] (25 PDB entries)
    Uniprot P05979 32-584
  8. 1460256Domain d1q4gb2: 1q4g B:32-73 [95792]
    Other proteins in same PDB: d1q4ga1, d1q4gb1
    complexed with bfl, bog, gol, hem

Details for d1q4gb2

PDB Entry: 1q4g (more details), 2 Å

PDB Description: 2.0 angstrom crystal structure of ovine prostaglandin h2 synthase-1, in complex with alpha-methyl-4-biphenylacetic acid
PDB Compounds: (B:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d1q4gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4gb2 g.3.11.1 (B:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d1q4gb2:

Click to download the PDB-style file with coordinates for d1q4gb2.
(The format of our PDB-style files is described here.)

Timeline for d1q4gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q4gb1