Lineage for d1q24a_ (1q24 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586596Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2586599Species Cow (Bos taurus) [TaxId:9913] [56118] (40 PDB entries)
    Uniprot P00517
  8. 2586641Domain d1q24a_: 1q24 A: [95618]
    double mutant model of PKB; complexed with peptide inhibitor, chain B
    complexed with atp, mg; mutant

Details for d1q24a_

PDB Entry: 1q24 (more details), 2.6 Å

PDB Description: pka double mutant model of pkb in complex with mgatp
PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1q24a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q24a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki
ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyapggemfshlr
rigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyiqvtdfgfakrvkg
rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d1q24a_:

Click to download the PDB-style file with coordinates for d1q24a_.
(The format of our PDB-style files is described here.)

Timeline for d1q24a_: