Lineage for d1pzyb_ (1pzy B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706185Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 706186Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families) (S)
  5. 706195Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (1 protein)
  6. 706196Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 706197Species Cow (Bos taurus) [TaxId:9913] [53454] (19 PDB entries)
  8. 706225Domain d1pzyb_: 1pzy B: [95487]
    Other proteins in same PDB: d1pzya_, d1pzyc_

Details for d1pzyb_

PDB Entry: 1pzy (more details), 2.3 Å

PDB Description: w314a-beta1,4-galactosyltransferase-i complexed with alpha-lactalbumin in the presence of n-acetylglucosamine, udp and manganese
PDB Compounds: (B:) beta-1,4-galactosyltransferase

SCOP Domain Sequences for d1pzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzyb_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
wgaggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketml
sdglnsltymvlevqryplytkitvdigtps

SCOP Domain Coordinates for d1pzyb_:

Click to download the PDB-style file with coordinates for d1pzyb_.
(The format of our PDB-style files is described here.)

Timeline for d1pzyb_: