Lineage for d1pzkf_ (1pzk F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1313714Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1313715Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1313733Domain d1pzkf_: 1pzk F: [95453]
    complexed with j12

Details for d1pzkf_

PDB Entry: 1pzk (more details), 1.35 Å

PDB Description: cholera toxin b-pentamer complexed with n-acyl phenyl galactoside 9h
PDB Compounds: (F:) cholera toxin b subunit

SCOPe Domain Sequences for d1pzkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzkf_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1pzkf_:

Click to download the PDB-style file with coordinates for d1pzkf_.
(The format of our PDB-style files is described here.)

Timeline for d1pzkf_: