SCOPe 2.04: Domain d1pz8a_: 1pz8 A:

Lineage for d1pz8a_ (1pz8 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Agrin [101641] (1 species)
   alternative splicing

7. Species Chicken (Gallus gallus) [TaxId:9031] [101642] (4 PDB entries)

8. Domain d1pz8a_: 1pz8 A: [95407]
   complexed with ca

Details for d1pz8a_

PDB Entry: 1pz8, 2.35 Å

PDB Description: Modulation of agrin function by alternative splicing and Ca2+ binding

PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d1pz8a_:

Sequence, based on SEQRES records:

>d1pz8a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
eaiafdgrtymeyhnavtkshlsneipaekalqsnhfelsikteatqglilwsgkglers
dyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitg
ssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnn
ptilhc

Sequence, based on observed residues (ATOM records):

>d1pz8a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
eaiafdgrtymeyhnavaekalqsnhfelsikteatqglilwsgkglersdyialaivdg
fvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgssplgatqld
tdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnptilhc

Timeline for d1pz8a_:

• d1pz8a_ first appeared in SCOP 1.67
  
• d1pz8a_ appears in SCOPe 2.03
  
• d1pz8a_ appears in SCOPe 2.05
  
• d1pz8a_ appears in the current release, SCOPe 2.08