Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Alpha-l-arabinofuranosidase [101924] (2 species) glycosyl hydrolase family 51 |
Species Bacillus stearothermophilus [TaxId:1422] [101925] (5 PDB entries) |
Domain d1pz2b1: 1pz2 B:5-17,B:385-501 [95394] Other proteins in same PDB: d1pz2a2, d1pz2b2 complexed with ahr |
PDB Entry: 1pz2 (more details), 2 Å
SCOPe Domain Sequences for d1pz2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pz2b1 b.71.1.2 (B:5-17,B:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus [TaxId: 1422]} katmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnrdm edalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsatlp klswnvirlgk
Timeline for d1pz2b1: