Lineage for d1pyya1 (1pyy A:632-692)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852634Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 852635Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 852636Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 852637Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 852638Species Streptococcus pneumoniae [TaxId:1313] [54187] (10 PDB entries)
  8. 852639Domain d1pyya1: 1pyy A:632-692 [95385]
    Other proteins in same PDB: d1pyya3, d1pyya4

Details for d1pyya1

PDB Entry: 1pyy (more details), 2.42 Å

PDB Description: double mutant pbp2x t338a/m339f from streptococcus pneumoniae strain r6 at 2.4 a resolution
PDB Compounds: (A:) penicillin-binding protein 2x

SCOP Domain Sequences for d1pyya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyya1 d.11.1.1 (A:632-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
qqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlilsd
k

SCOP Domain Coordinates for d1pyya1:

Click to download the PDB-style file with coordinates for d1pyya1.
(The format of our PDB-style files is described here.)

Timeline for d1pyya1: