Lineage for d1pvmb3 (1pvm B:143-178)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037361Superfamily g.41.13: Hypothetical protein Ta0289 C-terminal domain [103623] (1 family) (S)
    contains CxxC-x(n)-CxxxxC zinc-binding site; sequence similarity to NAD-dependent DNA ligase zinc-finger subdomain
  5. 3037362Family g.41.13.1: Hypothetical protein Ta0289 C-terminal domain [103624] (1 protein)
  6. 3037363Protein Hypothetical protein Ta0289 C-terminal domain [103625] (1 species)
  7. 3037364Species Thermoplasma acidophilum [TaxId:2303] [103626] (1 PDB entry)
  8. 3037366Domain d1pvmb3: 1pvm B:143-178 [95176]
    Other proteins in same PDB: d1pvma4, d1pvmb4, d1pvmb5
    structural genomics
    complexed with hg

Details for d1pvmb3

PDB Entry: 1pvm (more details), 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum
PDB Compounds: (B:) conserved hypothetical protein Ta0289

SCOPe Domain Sequences for d1pvmb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvmb3 g.41.13.1 (B:143-178) Hypothetical protein Ta0289 C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
qhlcpkcgvgvlepvynekgeikvfrcsnpacdyee

SCOPe Domain Coordinates for d1pvmb3:

Click to download the PDB-style file with coordinates for d1pvmb3.
(The format of our PDB-style files is described here.)

Timeline for d1pvmb3: