Lineage for d1ps6a_ (1ps6 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513605Family c.77.1.3: PdxA-like [102656] (2 proteins)
    Pfam PF04166; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PlsX-like and phosphotransacetylase families
  6. 2513606Protein 4-hydroxythreonine-4-phosphate dehydrogenase PdxA [102657] (2 species)
    pyridoxal phosphate biosynthetic protein
  7. 2513607Species Escherichia coli [TaxId:562] [102658] (3 PDB entries)
  8. 2513610Domain d1ps6a_: 1ps6 A: [95070]
    complexed with 4tp, zn

Details for d1ps6a_

PDB Entry: 1ps6 (more details), 2.25 Å

PDB Description: crystal structure of e.coli pdxa
PDB Compounds: (A:) 4-hydroxythreonine-4-phosphate dehydrogenase

SCOPe Domain Sequences for d1ps6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ps6a_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli [TaxId: 562]}
vktqrvvitpgepagigpdlvvqlaqrewpvelvvcadatlltnraamlglpltlrpysp
nspaqpqtagtltllpvalrapvtagqlavenghyvvetlaracdgclngefaalitgpv
hkgvindagipftghteffeersqakkvvmmlateelrvalatthlplrdiadaitpall
heviailhhdlrtkfgiaeprilvcglnphagegghmgteeidtiipvlnelraqgmkln
gplpadtlfqpkyldnadavlamyhdqglpvlkyqgfgrgvnitlglpfirtsvdhgtal
elagrgkadvgsfitalnlaikmivntq

SCOPe Domain Coordinates for d1ps6a_:

Click to download the PDB-style file with coordinates for d1ps6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ps6a_: