Lineage for d1pr9b_ (1pr9 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387288Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (40 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 387382Protein Carbonyl reductase [51765] (2 species)
  7. 387383Species Human (Homo sapiens) [TaxId:9606] [102144] (1 PDB entry)
    dicarbonyl/L-xylulose reductase
  8. 387385Domain d1pr9b_: 1pr9 B: [95061]
    complexed with 2hp, k, nap

Details for d1pr9b_

PDB Entry: 1pr9 (more details), 1.96 Å

PDB Description: human l-xylulose reductase holoenzyme

SCOP Domain Sequences for d1pr9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pr9b_ c.2.1.2 (B:) Carbonyl reductase {Human (Homo sapiens)}
melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
fwac

SCOP Domain Coordinates for d1pr9b_:

Click to download the PDB-style file with coordinates for d1pr9b_.
(The format of our PDB-style files is described here.)

Timeline for d1pr9b_: