SCOP 1.73: Domain d1pp8o_: 1pp8 O:

Lineage for d1pp8o_ (1pp8 O:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.44: 39 kda initiator binding protein, IBP39, N-terminal domain [101045] (1 protein)

6. Protein 39 kda initiator binding protein, IBP39, N-terminal domain [101046] (1 species)

7. Species Trichomonas vaginalis [TaxId:5722] [101047] (2 PDB entries)

8. Domain d1pp8o_: 1pp8 O: [94976]

Details for d1pp8o_

PDB Entry: 1pp8, 3.05 Å

PDB Description: crystal structure of the T. vaginalis IBP39 Initiator binding domain (IBD) bound to the alpha-SCS Inr element

PDB Compounds: (O:) 39 kDa initiator binding protein

SCOP Domain Sequences for d1pp8o_:

Sequence, based on SEQRES records:

>d1pp8o_ a.4.5.44 (O:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis [TaxId: 5722]}
ftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswisdtefkmkk
knvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsv

Sequence, based on observed residues (ATOM records):

>d1pp8o_ a.4.5.44 (O:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis [TaxId: 5722]}
ftsrlppeivaalkrfprklhmlltylasnpqleeeiglswisdtefkmkkknvalvmgi
klntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsv

Timeline for d1pp8o_:

• d1pp8o_ first appeared in SCOP 1.67
  
• d1pp8o_ appears in SCOP 1.71
  
• d1pp8o_ appears in SCOP 1.75
  
• d1pp8o_ appears in the current release, SCOPe 2.08