Lineage for d1pp8f_ (1pp8 F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635724Family a.4.5.44: 39 kda initiator binding protein, IBP39, N-terminal domain [101045] (1 protein)
  6. 635725Protein 39 kda initiator binding protein, IBP39, N-terminal domain [101046] (1 species)
  7. 635726Species Trichomonas vaginalis [TaxId:5722] [101047] (2 PDB entries)
  8. 635728Domain d1pp8f_: 1pp8 F: [94974]

Details for d1pp8f_

PDB Entry: 1pp8 (more details), 3.05 Å

PDB Description: crystal structure of the T. vaginalis IBP39 Initiator binding domain (IBD) bound to the alpha-SCS Inr element
PDB Compounds: (F:) 39 kDa initiator binding protein

SCOP Domain Sequences for d1pp8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp8f_ a.4.5.44 (F:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis [TaxId: 5722]}
dsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswis
dtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrns

SCOP Domain Coordinates for d1pp8f_:

Click to download the PDB-style file with coordinates for d1pp8f_.
(The format of our PDB-style files is described here.)

Timeline for d1pp8f_: