Lineage for d1pp7u_ (1pp7 U:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259765Family a.4.5.44: 39 kda initiator binding protein, IBP39, N-terminal domain [101045] (1 protein)
    automatically mapped to Pfam PF10416
  6. 1259766Protein 39 kda initiator binding protein, IBP39, N-terminal domain [101046] (1 species)
  7. 1259767Species Trichomonas vaginalis [TaxId:5722] [101047] (2 PDB entries)
  8. 1259768Domain d1pp7u_: 1pp7 U: [94973]
    protein/DNA complex; complexed with zn

Details for d1pp7u_

PDB Entry: 1pp7 (more details), 2.45 Å

PDB Description: Crystal structure of the T. vaginalis Initiator binding protein bound to the ferredoxin Inr
PDB Compounds: (U:) 39 kDa initiator binding protein

SCOPe Domain Sequences for d1pp7u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp7u_ a.4.5.44 (U:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis [TaxId: 5722]}
dleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswisdte
fkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfed

SCOPe Domain Coordinates for d1pp7u_:

Click to download the PDB-style file with coordinates for d1pp7u_.
(The format of our PDB-style files is described here.)

Timeline for d1pp7u_: