SCOP 1.67: Domain d1pjsa2: 1pjs A:216-457

Lineage for d1pjsa2 (1pjs A:216-457)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (3 proteins)

6. Protein Siroheme synthase CysG, domains 4 and 5 [102682] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [102683] (3 PDB entries)

8. Domain d1pjsa2: 1pjs A:216-457 [94773]
   Other proteins in same PDB: d1pjsa1, d1pjsa3, d1pjsb1, d1pjsb3

Details for d1pjsa2

PDB Entry: 1pjs, 2.4 Å

PDB Description: The co-crystal structure of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis, in complex with it NAD cofactor

SCOP Domain Sequences for d1pjsa2:

Sequence, based on SEQRES records:

>d1pjsa2 c.90.1.1 (A:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records):

>d1pjsa2 c.90.1.1 (A:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvvpqeein
qillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsaysgip
lthrdyaqsvrlvtgeldwenlaaekqtlvfymglnqaatiqekliafgmqadmpvalve
ngtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

Timeline for d1pjsa2:

• d1pjsa2 is new in SCOP 1.67
  
• d1pjsa2 appears in SCOP 1.69
  
• d1pjsa2 appears in the current release, SCOPe 2.08