SCOPe 2.07: Domain d1pj3c2: 1pj3 C:2021-2279

Lineage for d1pj3c2 (1pj3 C:2021-2279)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1pj3c2: 1pj3 C:2021-2279 [94731]
   Other proteins in same PDB: d1pj3a1, d1pj3b1, d1pj3c1, d1pj3d1
   complexed with fum, mn, nad, pyr

Details for d1pj3c2

PDB Entry: 1pj3, 2.1 Å

PDB Description: Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme in a pentary complex with natural substrate pyruvate, cofactor NAD+, Mn++, and allosteric activator fumarate.

PDB Compounds: (C:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pj3c2:

Sequence; same for both SEQRES and ATOM records:

>d1pj3c2 c.58.1.3 (C:2021-2279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

Timeline for d1pj3c2:

• d1pj3c2 first appeared in SCOP 1.67
  
• d1pj3c2 appears in SCOPe 2.06
  
• d1pj3c2 appears in the current release, SCOPe 2.08