Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins) Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand |
Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries) |
Domain d1pj2a2: 1pj2 A:21-279 [94719] Other proteins in same PDB: d1pj2a1, d1pj2b1, d1pj2c1, d1pj2d1 complexed with fum, mlt, mn, nai |
PDB Entry: 1pj2 (more details), 2.3 Å
SCOPe Domain Sequences for d1pj2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pj2a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh nafrflrkyrekyctfndd
Timeline for d1pj2a2: