Lineage for d1pg7l2 (1pg7 L:108-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656035Domain d1pg7l2: 1pg7 L:108-213 [94679]
    Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l1, d1pg7m1, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z1, d1pg7z2

Details for d1pg7l2

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab
PDB Compounds: (L:) humanized antibody D3H44

SCOP Domain Sequences for d1pg7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg7l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1pg7l2:

Click to download the PDB-style file with coordinates for d1pg7l2.
(The format of our PDB-style files is described here.)

Timeline for d1pg7l2: