SCOP 1.73: Domain d1p8zg_: 1p8z G:

Lineage for d1p8zg_ (1p8z G:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.109: Gelsolin-like [55752] (2 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (24 PDB entries)

8. Domain d1p8zg_: 1p8z G: [94376]
   Other proteins in same PDB: d1p8za1, d1p8za2
   domain 1 with a domain 2 linker
   complexed with atp, ca, cd

Details for d1p8zg_

PDB Entry: 1p8z, 2.6 Å

PDB Description: Complex Between Rabbit Muscle alpha-Actin: Human Gelsolin Residues Val26-Glu156

PDB Compounds: (G:) Gelsolin precursor, plasma

SCOP Domain Sequences for d1p8zg_:

Sequence; same for both SEQRES and ATOM records:

>d1p8zg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asgfkhvvpne

Timeline for d1p8zg_:

• d1p8zg_ first appeared in SCOP 1.67
  
• d1p8zg_ appears in SCOP 1.71
  
• d1p8zg_ appears in SCOP 1.75
  
• d1p8zg_ appears in the current release, SCOPe 2.08