Lineage for d1p8zg_ (1p8z G:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417014Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 417015Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 417016Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 417017Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 417031Species Human (Homo sapiens) [TaxId:9606] [55761] (17 PDB entries)
  8. 417051Domain d1p8zg_: 1p8z G: [94376]
    Other proteins in same PDB: d1p8za1, d1p8za2
    domain 1 with a domain 2 linker
    complexed with atp, ca, cd

Details for d1p8zg_

PDB Entry: 1p8z (more details), 2.6 Å

PDB Description: Complex Between Rabbit Muscle alpha-Actin: Human Gelsolin Residues Val26-Glu156

SCOP Domain Sequences for d1p8zg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8zg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asgfkhvvpne

SCOP Domain Coordinates for d1p8zg_:

Click to download the PDB-style file with coordinates for d1p8zg_.
(The format of our PDB-style files is described here.)

Timeline for d1p8zg_: