Lineage for d1p8cd_ (1p8c D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348132Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2348133Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2348163Family a.152.1.2: CMD-like [101468] (2 proteins)
    Pfam PF02627; hexamer of single-domain subunits
  6. 2348175Protein Hypothetical protein TM1620 [101469] (1 species)
  7. 2348176Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries)
    Uniprot Q9X1V5
  8. 2348186Domain d1p8cd_: 1p8c D: [94357]
    structural genomics; MCSG target APC4843

Details for d1p8cd_

PDB Entry: 1p8c (more details), 2.3 Å

PDB Description: Crystal structure of TM1620 (APC4843) from Thermotoga maritima
PDB Compounds: (D:) conserved hypothetical protein

SCOPe Domain Sequences for d1p8cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8cd_ a.152.1.2 (D:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]}
eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngeti

SCOPe Domain Coordinates for d1p8cd_:

Click to download the PDB-style file with coordinates for d1p8cd_.
(The format of our PDB-style files is described here.)

Timeline for d1p8cd_: