Lineage for d1p7jb_ (1p7j B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1257873Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1257885Protein Engrailed Homeodomain [46691] (1 species)
  7. 1257886Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 1257896Domain d1p7jb_: 1p7j B: [94284]
    complexed with nhe; mutant

Details for d1p7jb_

PDB Entry: 1p7j (more details), 2.1 Å

PDB Description: crystal structure of engrailed homeodomain mutant k52e
PDB Compounds: (B:) Segmentation polarity homeobox protein engrailed

SCOPe Domain Sequences for d1p7jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7jb_ a.4.1.1 (B:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
afsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnerakik

SCOPe Domain Coordinates for d1p7jb_:

Click to download the PDB-style file with coordinates for d1p7jb_.
(The format of our PDB-style files is described here.)

Timeline for d1p7jb_: