Lineage for d1p7gs1 (1p7g S:12-103)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437446Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 437447Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 437475Protein Fe superoxide dismutase (FeSOD) [46611] (9 species)
  7. 437485Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [100984] (1 PDB entry)
  8. 437504Domain d1p7gs1: 1p7g S:12-103 [94259]
    Other proteins in same PDB: d1p7ga2, d1p7gb2, d1p7gc2, d1p7gd2, d1p7ge2, d1p7gf2, d1p7gg2, d1p7gh2, d1p7gi2, d1p7gj2, d1p7gk2, d1p7gl2, d1p7gm2, d1p7gn2, d1p7go2, d1p7gp2, d1p7gq2, d1p7gr2, d1p7gs2, d1p7gt2, d1p7gu2, d1p7gv2, d1p7gw2, d1p7gx2

Details for d1p7gs1

PDB Entry: 1p7g (more details), 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum

SCOP Domain Sequences for d1p7gs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7gs1 a.2.11.1 (S:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum}
svttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqi
diravlrdlsfhlnghilhsifwpnmappgkg

SCOP Domain Coordinates for d1p7gs1:

Click to download the PDB-style file with coordinates for d1p7gs1.
(The format of our PDB-style files is described here.)

Timeline for d1p7gs1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7gs2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p7ga1, d1p7ga2, d1p7gb1, d1p7gb2, d1p7gc1, d1p7gc2, d1p7gd1, d1p7gd2, d1p7ge1, d1p7ge2, d1p7gf1, d1p7gf2, d1p7gg1, d1p7gg2, d1p7gh1, d1p7gh2, d1p7gi1, d1p7gi2, d1p7gj1, d1p7gj2, d1p7gk1, d1p7gk2, d1p7gl1, d1p7gl2, d1p7gm1, d1p7gm2, d1p7gn1, d1p7gn2, d1p7go1, d1p7go2, d1p7gp1, d1p7gp2, d1p7gq1, d1p7gq2, d1p7gr1, d1p7gr2, d1p7gt1, d1p7gt2, d1p7gu1, d1p7gu2, d1p7gv1, d1p7gv2, d1p7gw1, d1p7gw2, d1p7gx1, d1p7gx2