Lineage for d1p4pa_ (1p4p A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422468Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2422469Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2422470Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 2422478Protein Outer surface protein B [101946] (1 species)
  7. 2422479Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [101947] (2 PDB entries)
    Uniprot P17739 202-296
  8. 2422480Domain d1p4pa_: 1p4p A: [94112]
    C-terminal, "globular" region only (of 12 strands)

Details for d1p4pa_

PDB Entry: 1p4p (more details), 2 Å

PDB Description: Outer Surface Protein B of B. burgdorferi: crystal structure of the C-terminal fragment
PDB Compounds: (A:) Outer surface protein B

SCOPe Domain Sequences for d1p4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4pa_ b.76.1.1 (A:) Outer surface protein B {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
skkltrsngttleysqitdadnatkavetlknsiklegslvvgkttveikegtvtlkrei
ekdgkvkvflndtagsnkktgkwedststltisadskktkdlvfltdgtitvqqyntagt
slegsaseiknlselknalk

SCOPe Domain Coordinates for d1p4pa_:

Click to download the PDB-style file with coordinates for d1p4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1p4pa_: