Lineage for d1p3mc_ (1p3m C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764838Protein Histone H2A [47115] (6 species)
  7. 764839Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries)
  8. 764874Domain d1p3mc_: 1p3m C: [94042]
    Other proteins in same PDB: d1p3ma_, d1p3mb_, d1p3md_, d1p3me_, d1p3mf_, d1p3mh_

Details for d1p3mc_

PDB Entry: 1p3m (more details), 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (C:) histone h2a

SCOP Domain Sequences for d1p3mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3mc_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

SCOP Domain Coordinates for d1p3mc_:

Click to download the PDB-style file with coordinates for d1p3mc_.
(The format of our PDB-style files is described here.)

Timeline for d1p3mc_: