Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins) |
Protein Ribonuclease PH, domain 1 [102758] (3 species) |
Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries) |
Domain d1oyrf1: 1oyr F:1-151 [93756] Other proteins in same PDB: d1oyra2, d1oyrb2, d1oyrc2, d1oyrd2, d1oyre2, d1oyrf2 complexed with cd, sul |
PDB Entry: 1oyr (more details), 3.1 Å
SCOP Domain Sequences for d1oyrf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyrf1 d.14.1.4 (F:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq adggtrtasitgaflamaiaigklikagtik
Timeline for d1oyrf1: