Lineage for d1oyrf1 (1oyr F:1-151)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853367Protein Ribonuclease PH, domain 1 [102758] (3 species)
  7. 853373Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)
  8. 853386Domain d1oyrf1: 1oyr F:1-151 [93756]
    Other proteins in same PDB: d1oyra2, d1oyrb2, d1oyrc2, d1oyrd2, d1oyre2, d1oyrf2
    complexed with cd, sul

Details for d1oyrf1

PDB Entry: 1oyr (more details), 3.1 Å

PDB Description: Crystal structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis
PDB Compounds: (F:) Ribonuclease PH

SCOP Domain Sequences for d1oyrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyrf1 d.14.1.4 (F:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

SCOP Domain Coordinates for d1oyrf1:

Click to download the PDB-style file with coordinates for d1oyrf1.
(The format of our PDB-style files is described here.)

Timeline for d1oyrf1: