SCOP 1.75: Domain d1oyrc2: 1oyr C:152-242

Lineage for d1oyrc2 (1oyr C:152-242)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)

6. Protein Ribonuclease PH, domain 2 [103150] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries)

8. Domain d1oyrc2: 1oyr C:152-242 [93751]
   Other proteins in same PDB: d1oyra1, d1oyrb1, d1oyrc1, d1oyrd1, d1oyre1, d1oyrf1

Details for d1oyrc2

PDB Entry: 1oyr, 3.1 Å

PDB Description: Crystal structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

PDB Compounds: (C:) Ribonuclease PH

SCOP Domain Sequences for d1oyrc2:

Sequence; same for both SEQRES and ATOM records:

>d1oyrc2 d.101.1.1 (C:152-242) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]}
tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs
redlngllglaekgiqelidkqkevlgdslp

Timeline for d1oyrc2:

• d1oyrc2 first appeared in SCOP 1.67
  
• d1oyrc2 appears in SCOP 1.73
  
• d1oyrc2 appears in SCOPe 2.01
  
• d1oyrc2 appears in the current release, SCOPe 2.08