Lineage for d1oyrb1 (1oyr B:1-151)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716847Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (2 proteins)
  6. 716854Protein Ribonuclease PH, domain 1 [102758] (3 species)
  7. 716860Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)
  8. 716869Domain d1oyrb1: 1oyr B:1-151 [93748]
    Other proteins in same PDB: d1oyra2, d1oyrb2, d1oyrc2, d1oyrd2, d1oyre2, d1oyrf2

Details for d1oyrb1

PDB Entry: 1oyr (more details), 3.1 Å

PDB Description: Crystal structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis
PDB Compounds: (B:) Ribonuclease PH

SCOP Domain Sequences for d1oyrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyrb1 d.14.1.4 (B:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

SCOP Domain Coordinates for d1oyrb1:

Click to download the PDB-style file with coordinates for d1oyrb1.
(The format of our PDB-style files is described here.)

Timeline for d1oyrb1: