Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins) |
Protein Ribonuclease PH, domain 2 [103150] (4 species) |
Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries) |
Domain d1oypa2: 1oyp A:152-243 [93735] Other proteins in same PDB: d1oypa1, d1oypb1, d1oypc1, d1oypd1, d1oype1, d1oypf1 complexed with so4 |
PDB Entry: 1oyp (more details), 2.76 Å
SCOPe Domain Sequences for d1oypa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oypa2 d.101.1.1 (A:152-243) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]} tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs redlngllglaekgiqelidkqkevlgdslpe
Timeline for d1oypa2: