![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) ![]() |
![]() | Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins) |
![]() | Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
![]() | Species Anacystis nidulans [52429] (6 PDB entries) cofactor is HDF |
![]() | Domain d1owna2: 1own A:2-204 [93652] Other proteins in same PDB: d1owna1 complexed with fad, po4 |
PDB Entry: 1own (more details), 2.3 Å
SCOP Domain Sequences for d1owna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owna2 c.28.1.1 (A:2-204) DNA photolyase {Anacystis nidulans} aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta iaplllselptlkqlgfdwdggf
Timeline for d1owna2: