Lineage for d1otjd_ (1otj D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381367Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 381424Family b.82.2.5: TauD/TfdA-like [75038] (2 proteins)
  6. 381441Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (1 species)
  7. 381442Species Escherichia coli [TaxId:562] [75040] (4 PDB entries)
  8. 381446Domain d1otjd_: 1otj D: [93520]
    complexed with cl, tau

Details for d1otjd_

PDB Entry: 1otj (more details), 1.9 Å

PDB Description: Crystal structure of APO (iron-free) TauD

SCOP Domain Sequences for d1otjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otjd_ b.82.2.5 (D:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli}
erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp
pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp
ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyra

SCOP Domain Coordinates for d1otjd_:

Click to download the PDB-style file with coordinates for d1otjd_.
(The format of our PDB-style files is described here.)

Timeline for d1otjd_: