Class b: All beta proteins [48724] (141 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.5: TauD/TfdA-like [75038] (2 proteins) |
Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (1 species) |
Species Escherichia coli [TaxId:562] [75040] (4 PDB entries) |
Domain d1otjd_: 1otj D: [93520] complexed with cl, tau |
PDB Entry: 1otj (more details), 1.9 Å
SCOP Domain Sequences for d1otjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otjd_ b.82.2.5 (D:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli} erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyra
Timeline for d1otjd_: