Lineage for d1ok3a3 (1ok3 A:129-190)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429210Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 429211Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 429212Family g.18.1.1: Complement control module/SCR domain [57536] (9 proteins)
  6. 429282Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 429283Species Human (Homo sapiens) [TaxId:9606] [90173] (14 PDB entries)
  8. 429292Domain d1ok3a3: 1ok3 A:129-190 [93210]

Details for d1ok3a3

PDB Entry: 1ok3 (more details), 2.2 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

SCOP Domain Sequences for d1ok3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok3a3 g.18.1.1 (A:129-190) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens)}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

SCOP Domain Coordinates for d1ok3a3:

Click to download the PDB-style file with coordinates for d1ok3a3.
(The format of our PDB-style files is described here.)

Timeline for d1ok3a3: