Lineage for d1ojyd4 (1ojy D:191-254)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523102Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 523103Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 523104Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins)
  6. 523182Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 523183Species Human (Homo sapiens) [TaxId:9606] [90173] (14 PDB entries)
  8. 523245Domain d1ojyd4: 1ojy D:191-254 [93189]
    intact protein

Details for d1ojyd4

PDB Entry: 1ojy (more details), 2.6 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

SCOP Domain Sequences for d1ojyd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojyd4 g.18.1.1 (D:191-254) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens)}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crgc

SCOP Domain Coordinates for d1ojyd4:

Click to download the PDB-style file with coordinates for d1ojyd4.
(The format of our PDB-style files is described here.)

Timeline for d1ojyd4: