Lineage for d1ojxj_ (1ojx J:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475346Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 475365Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 475366Species Archaeon Thermoproteus tenax [TaxId:2271] [102089] (3 PDB entries)
  8. 475376Domain d1ojxj_: 1ojx J: [93173]

Details for d1ojxj_

PDB Entry: 1ojx (more details), 1.9 Å

PDB Description: crystal structure of an archaeal fructose 1,6-bisphosphate aldolase

SCOP Domain Sequences for d1ojxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojxj_ c.1.10.1 (J:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvyg

SCOP Domain Coordinates for d1ojxj_:

Click to download the PDB-style file with coordinates for d1ojxj_.
(The format of our PDB-style files is described here.)

Timeline for d1ojxj_: