Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins) |
Protein Monoamine oxidase B [69673] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69674] (10 PDB entries) |
Domain d1ojdl2: 1ojd L:290-401 [93127] Other proteins in same PDB: d1ojda1, d1ojdb1, d1ojdc1, d1ojdd1, d1ojde1, d1ojdf1, d1ojdg1, d1ojdh1, d1ojdi1, d1ojdl1 complexed with fad, lda |
PDB Entry: 1ojd (more details), 3.1 Å
SCOP Domain Sequences for d1ojdl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojdl2 d.16.1.5 (L:290-401) Monoamine oxidase B {Human (Homo sapiens)} plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d1ojdl2: