![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (3 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins) molybdopterine enzyme |
![]() | Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [101827] (1 PDB entry) |
![]() | Domain d1ogya1: 1ogy A:682-801 [92952] Other proteins in same PDB: d1ogya2, d1ogyb_, d1ogyc2, d1ogyd_, d1ogye2, d1ogyf_, d1ogyg2, d1ogyh_, d1ogyi2, d1ogyj_, d1ogyk2, d1ogyl_, d1ogym2, d1ogyn_, d1ogyo2, d1ogyp_ |
PDB Entry: 1ogy (more details), 3.2 Å
SCOP Domain Sequences for d1ogya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogya1 b.52.2.2 (A:682-801) Periplasmic nitrate reductase alpha chain, NapA {Rhodobacter sphaeroides} pdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrglnrgsevrvi srrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtdfkkcavkiea
Timeline for d1ogya1: