Class b: All beta proteins [48724] (141 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (12 families) |
Family b.82.1.1: dTDP-sugar isomerase [51183] (2 proteins) |
Protein dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD [101973] (1 species) |
Species Amycolatopsis orientalis [TaxId:31958] [101974] (1 PDB entry) |
Domain d1ofnb_: 1ofn B: [92831] complexed with gol |
PDB Entry: 1ofn (more details), 1.5 Å
SCOP Domain Sequences for d1ofnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofnb_ b.82.1.1 (B:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis} mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq rqgllpdyttsqeierrltavpv
Timeline for d1ofnb_: