Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein) |
Protein S-adenosylmethionine synthetase [55975] (3 species) synonym: methionine adenosyltransferase, MAT |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries) |
Domain d1o9ta1: 1o9t A:17-116 [92685] complexed with both substrates ATP and methionine complexed with atp, k, met, mg, po4 |
PDB Entry: 1o9t (more details), 2.9 Å
SCOPe Domain Sequences for d1o9ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9ta1 d.130.1.1 (A:17-116) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]} gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqsp
Timeline for d1o9ta1: