Lineage for d1o93a3 (1o93 A:253-396)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582827Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2582828Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2582915Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries)
  8. 2582936Domain d1o93a3: 1o93 A:253-396 [92667]
    complexed with atp, k, lis, mg, po4

Details for d1o93a3

PDB Entry: 1o93 (more details), 3.49 Å

PDB Description: methionine adenosyltransferase complexed with atp and a l-methionine analogue
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1o93a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o93a3 d.130.1.1 (A:253-396) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglc
rrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiy
qktacyghfgrsefpwevpkklvf

SCOPe Domain Coordinates for d1o93a3:

Click to download the PDB-style file with coordinates for d1o93a3.
(The format of our PDB-style files is described here.)

Timeline for d1o93a3: