SCOP 1.71: Domain d1o92b3: 1o92 B:253-396

Lineage for d1o92b3 (1o92 B:253-396)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)

6. Protein S-adenosylmethionine synthetase [55975] (2 species)
   synonym: methionine adenosyltransferase, MAT

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries)

8. Domain d1o92b3: 1o92 B:253-396 [92664]
   complexed with adp, amb, k, mg, po4

Details for d1o92b3

PDB Entry: 1o92, 3.19 Å

PDB Description: methionine adenosyltransferase complexed with adp and a l-methionine analogue

SCOP Domain Sequences for d1o92b3:

Sequence; same for both SEQRES and ATOM records:

>d1o92b3 d.130.1.1 (B:253-396) S-adenosylmethionine synthetase {Rat (Rattus norvegicus)}
iggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglc
rrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiy
qktacyghfgrsefpwevpkklvf

Timeline for d1o92b3:

• d1o92b3 first appeared in SCOP 1.67
  
• d1o92b3 appears in SCOP 1.69
  
• d1o92b3 appears in SCOP 1.73
  
• d1o92b3 appears in the current release, SCOPe 2.08