SCOP 1.67: Domain d1o50a1: 1o50 A:-2-69

Lineage for d1o50a1 (1o50 A:-2-69)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (4 proteins)
   pairs of CBS domains dimerize to form a stable globular domain

6. Protein Hypothetical protein TM0935 [102895] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [102896] (1 PDB entry)

8. Domain d1o50a1: 1o50 A:-2-69 [92478]

Details for d1o50a1

PDB Entry: 1o50, 1.87 Å

PDB Description: crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 a resolution

SCOP Domain Sequences for d1o50a1:

Sequence; same for both SEQRES and ATOM records:

>d1o50a1 d.37.1.1 (A:-2-69) Hypothetical protein TM0935 {Thermotoga maritima}
hhhmkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhll
kvsgfhffgfip

Timeline for d1o50a1:

• d1o50a1 is new in SCOP 1.67
  
• d1o50a1 appears in SCOP 1.69
  
• d1o50a1 last appears in SCOP 1.73